PDB entry 1qt9

View 1qt9 on RCSB PDB site
Description: oxidized [2fe-2s] ferredoxin from anabaena pcc7119
Deposited on 1999-07-01, released 1999-12-02
The last revision prior to the SCOP 1.63 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.16
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qt9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt9A (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly