PDB entry 1qt1

View 1qt1 on RCSB PDB site
Description: crystal structure of xylose isomerase from streptomyces diastaticus no.7 m1033 at 1.85 a resolution
Class: isomerase
Keywords: isomerase, xylose isomerase, glucose isomerase, streptomyces, true space group
Deposited on 1999-06-29, released 2000-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (xylose isomerase)
    Species: Streptomyces diastaticus [TaxId:1956]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qt1a_
  • Chain 'B':
    Compound: protein (xylose isomerase)
    Species: Streptomyces diastaticus [TaxId:1956]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qt1b_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt1A (A:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt1B (B:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg