PDB entry 1qt1

View 1qt1 on RCSB PDB site
Description: crystal structure of xylose isomerase from streptomyces diastaticus no.7 m1033 at 1.85 a resolution
Deposited on 1999-06-29, released 2000-06-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-29, with a file datestamp of 2000-06-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qt1a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qt1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt1A (A:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt1B (B:)
    syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
    gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
    pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
    pdaaaargmaferldqlamdhllgarg