PDB entry 1qsy

View 1qsy on RCSB PDB site
Description: DDATP-Trapped closed ternary complex of the large fragment of DNA Polymerase I from thermus aquaticus
Deposited on 1999-06-24, released 1999-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsyA (A:)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeergll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak