PDB entry 1qsv

View 1qsv on RCSB PDB site
Description: the vegf-binding domain of flt-1, 20 nmr structures
Deposited on 1999-06-23, released 1999-11-10
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qsva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsvA (A:)
    sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
    rkgfiisnatykeiglltceatvnghlyktnylthrqtnti