PDB entry 1qsv

View 1qsv on RCSB PDB site
Description: the vegf-binding domain of flt-1, 20 nmr structures
Class: hormone/growth factor receptor
Keywords: immunoglobulin-like domain, I-set, vegf receptor, hormone/growth factor receptor complex
Deposited on 1999-06-23, released 1999-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsvA (A:)
    sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
    rkgfiisnatykeiglltceatvnghlyktnylthrqtnti