PDB entry 1qst

View 1qst on RCSB PDB site
Description: crystal structure of tetrahymena gcn5
Deposited on 1999-06-23, released 1999-09-08
The last revision prior to the SCOP 1.59 freeze date was dated 1999-09-08, with a file datestamp of 1999-09-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.244
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qsta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qstA (A:)
    ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
    gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
    fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdy