PDB entry 1qsr

View 1qsr on RCSB PDB site
Description: crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a
Deposited on 1999-06-23, released 1999-09-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qsra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsrA (A:)
    ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
    gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
    fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr