PDB entry 1qsr

View 1qsr on RCSB PDB site
Description: crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a
Class: transferase
Keywords: histone acetyltransferase, gcn5-related n-acetyltransferase, coa-binding protein
Deposited on 1999-06-23, released 1999-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tgcn5 histone acetyl transferase
    Species: Tetrahymena thermophila [TaxId:5911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qsra1, d1qsra2
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsrA (A:)
    ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
    gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
    fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr