PDB entry 1qsm

View 1qsm on RCSB PDB site
Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae in Complex with Acetyl Coenzyme A
Deposited on 1999-06-22, released 1999-12-22
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qsma_
  • Chain 'B':
    Domains in SCOP 1.67: d1qsmb_
  • Chain 'C':
    Domains in SCOP 1.67: d1qsmc_
  • Chain 'D':
    Domains in SCOP 1.67: d1qsmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qsmA (A:)
    sednitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavaves
    ssekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsv
    ywctdesnhraqllyvkvgykapkilykrkgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsmA (A:)
    dnitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavesss
    ekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvyw
    ctdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qsmB (B:)
    sednitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavaves
    ssekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsv
    ywctdesnhraqllyvkvgykapkilykrkgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsmB (B:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qsmC (C:)
    sednitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavaves
    ssekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsv
    ywctdesnhraqllyvkvgykapkilykrkgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsmC (C:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsmD (D:)
    sednitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavaves
    ssekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsv
    ywctdesnhraqllyvkvgykapkilykrkgy