PDB entry 1qsl

View 1qsl on RCSB PDB site
Description: klenow fragment complexed with single-stranded substrate and europium (iii) ion
Deposited on 1999-06-22, released 1999-06-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qslA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qslA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvi
    leyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegr
    rirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglple
    tvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertra
    qakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawl
    qaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqa
    h