PDB entry 1qsj

View 1qsj on RCSB PDB site
Description: n-terminally truncated c3dg fragment
Class: immune system
Keywords: alpha-alpha barrel, immune system
Deposited on 1999-06-22, released 2000-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c3 precursor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01026 (0-End)
      • engineered (71-72)
      • engineered (75)
    Domains in SCOPe 2.07: d1qsja_
  • Chain 'B':
    Compound: complement c3 precursor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01026 (0-End)
      • engineered (71-72)
      • engineered (75)
    Domains in SCOPe 2.07: d1qsjb_
  • Chain 'C':
    Compound: complement c3 precursor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01026 (0-End)
      • engineered (71-72)
      • engineered (75)
    Domains in SCOPe 2.07: d1qsjc_
  • Chain 'D':
    Compound: complement c3 precursor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01026 (0-End)
      • engineered (71-72)
      • engineered (75)
    Domains in SCOPe 2.07: d1qsjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qsjA (A:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyradv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsjA (A:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyrad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qsjB (B:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyradv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsjB (B:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyrad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qsjC (C:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyradv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsjC (C:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyrad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qsjD (D:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyradv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsjD (D:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyrad