PDB entry 1qsg

View 1qsg on RCSB PDB site
Description: crystal structure of enoyl reductase inhibition by triclosan
Deposited on 1999-06-21, released 1999-07-21
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qsga_
  • Chain 'B':
    Domains in SCOP 1.71: d1qsgb_
  • Chain 'C':
    Domains in SCOP 1.71: d1qsgc_
  • Chain 'D':
    Domains in SCOP 1.71: d1qsgd_
  • Chain 'E':
    Domains in SCOP 1.71: d1qsge_
  • Chain 'F':
    Domains in SCOP 1.71: d1qsgf_
  • Chain 'G':
    Domains in SCOP 1.71: d1qsgg_
  • Chain 'H':
    Domains in SCOP 1.71: d1qsgh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qsgA (A:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgA (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qsgB (B:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgB (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qsgC (C:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgC (C:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qsgD (D:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgD (D:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qsgE (E:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgE (E:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qsgF (F:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgF (F:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qsgG (G:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgG (G:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnele
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qsgH (H:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgH (H:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel