PDB entry 1qsg

View 1qsg on RCSB PDB site
Description: crystal structure of enoyl reductase inhibition by triclosan
Class: oxidoreductase
Keywords: enoyl reductase, oxidoreductase
Deposited on 1999-06-21, released 1999-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsga1, d1qsga2
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgb1, d1qsgb2
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgc1, d1qsgc2
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgd1, d1qsgd2
  • Chain 'E':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsge1, d1qsge2
  • Chain 'F':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgf1, d1qsgf2
  • Chain 'G':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgg1, d1qsgg2
  • Chain 'H':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qsgh1, d1qsgh2
  • Heterogens: GLC, NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qsgA (A:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgA (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qsgB (B:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgB (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qsgC (C:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgC (C:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qsgD (D:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgD (D:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qsgE (E:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgE (E:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qsgF (F:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgF (F:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qsgG (G:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgG (G:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnele
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qsgH (H:)
    gshmgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgs
    divlqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiah
    dissysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanam
    gpegvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdls
    agisgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qsgH (H:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel