PDB entry 1qsa

View 1qsa on RCSB PDB site
Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.65 angstroms resolution
Class: transferase
Keywords: alpha-superhelix, transferase
Deposited on 1999-06-20, released 1999-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (soluble lytic transglycosylase slt70)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qsaa1, d1qsaa2
  • Heterogens: SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsaA (A:)
    dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
    fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
    awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
    padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
    aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
    rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
    geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
    ryafnnqwwdlsvqatiagklwdhleerfplayndlfkrytsgkeipqsyamaiarqesa
    wnpkvkspvgasglmqimpgtathtvkmfsipgysspgqlldpetninigtsylqyvyqq
    fgnnrifssaaynagpgrvrtwlgnsagridavafvesipfsetrgyvknvlaydayyry
    fmgdkptlmsatewgrry