PDB entry 1qs9

View 1qs9 on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Deposited on 1999-06-25, released 1999-07-02
The last revision prior to the SCOP 1.59 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qs9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qs9A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrravlinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk