PDB entry 1qs8

View 1qs8 on RCSB PDB site
Description: Crystal structure of the P. vivax aspartic proteinase plasmepsin complexed with the inhibitor pepstatin A
Deposited on 1999-06-25, released 1999-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-07, with a file datestamp of 1999-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qs8a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qs8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs8A (A:)
    sendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyds
    sksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssvef
    dgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfyeg
    nityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikvp
    flpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntfi
    lgdpfmrkyftvfdydkesvgfaiakn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs8B (B:)
    gsendvielddvanimfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlyd
    ssksksyekdgtkvditygsgtvkgffskdlvtlghlsmpykfievidtddlepiyssve
    fdgilglgwkdlsigsidpivvelknqnkidnalftfylpvhdvhagyltiggieekfye
    gnityeklnhdlywqidldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikv
    pflpfyvttcdnkemptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntf
    ilgdpfmrkyftvfdydkesvgfaiakn