PDB entry 1qs5

View 1qs5 on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Class: hydrolase
Keywords: strain, stability, mutant, t4 lysozyme, hydrolase
Deposited on 1999-06-25, released 1999-07-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.129
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-161)
      • engineered (53)
      • engineered (96-97)
    Domains in SCOPe 2.03: d1qs5a_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs5A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrallinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk