PDB entry 1qs5

View 1qs5 on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Deposited on 1999-06-25, released 1999-07-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qs5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qs5A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrallinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk