PDB entry 1qs2

View 1qs2 on RCSB PDB site
Description: crystal structure of vip2 with nad
Class: toxin
Keywords: alpha-beta protein, protein-nad complex, binary toxin
Deposited on 1999-06-25, released 1999-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyltransferase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QS2 (0-400)
    Domains in SCOPe 2.08: d1qs2a1, d1qs2a2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs2A (A:)
    kvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsfed
    eikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfldrd
    ikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngymvh
    vdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqrealdg
    yarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyqis
    dplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsaig
    gfasekeilldkdskyhidkvteviikgvkryvvdatlltn