PDB entry 1qs1

View 1qs1 on RCSB PDB site
Description: crystal structure of vegetative insecticidal protein2 (vip2)
Deposited on 1999-06-25, released 1999-12-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.235
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs1A (A:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs1B (B:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs1C (C:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs1D (D:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt