PDB entry 1qs0

View 1qs0 on RCSB PDB site
Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
Deposited on 1999-06-24, released 1999-08-18
The last revision prior to the SCOP 1.65 freeze date was dated 1999-08-18, with a file datestamp of 1999-08-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs0A (A:)
    neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
    gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
    alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
    gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
    nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
    iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
    eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qs0B (B:)
    atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
    esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
    gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
    pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
    sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
    apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev