PDB entry 1qry

View 1qry on RCSB PDB site
Description: Homeobox protein VND (ventral nervous system defective protein)
Class: DNA-binding protein
Keywords: helix-turn-helix, DNA-binding protein
Deposited on 1999-06-16, released 1999-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (homeobox ventral nervous system defective protein)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qrya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qryA (A:)
    gshmsdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehltslirltptqvkiwf
    qnhryktkraqnekgyeghp