SCOPe 2.08: Structural Classification of Proteins

PDB entry 1qry

View 1qry on RCSB PDB site
Description: Homeobox protein VND (ventral nervous system defective protein)
Class: DNA-binding protein
Keywords: helix-turn-helix, DNA-binding protein
Deposited on 1999-06-16, released 1999-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: protein (homeobox ventral nervous system defective protein)
Species: Drosophila melanogaster [TaxId:7227]
Database cross-references and differences (RAF-indexed):
- Uniprot P22808 (4-79)
Domains in SCOPe 2.08: d1qrya1, d1qrya2

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1qryA (A:)
gshmsdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehltslirltptqvkiwf
qnhryktkraqnekgyeghp