PDB entry 1qrv

View 1qrv on RCSB PDB site
Description: crystal structure of the complex of hmg-d and DNA
Class: gene regulation/DNA
Keywords: protein-DNA complex, hmg domain, non-sequence specific chromosomal protein hmg-d, gene regulation/DNA complex
Deposited on 1999-06-15, released 1999-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qrva_
  • Chain 'B':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qrvb_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3')
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qrvA (A:)
    sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qrvB (B:)
    sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qrvB (B:)
    dkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakdd
    ydravkefean
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.