PDB entry 1qrt

View 1qrt on RCSB PDB site
Description: glutaminyl-trna synthetase mutant d235g complexed with glutamine transfer rna
Deposited on 1996-06-14, released 1996-12-07
The last revision prior to the SCOP 1.69 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qrtA (A:)
    seaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgq
    cnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglay
    vdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmas
    pfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqgnrrly
    dwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrg
    ytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgeg
    emvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikae
    rvekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvpn
    pgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfnr
    tvglrdtwakvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qrtA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqgnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt