PDB entry 1qrr

View 1qrr on RCSB PDB site
Description: crystal structure of sqd1 protein complex with nad and udp-glucose
Class: isomerase
Keywords: rossmann fold, short hydrogen bonds, sdr homolog
Deposited on 1999-06-15, released 1999-11-10
The last revision prior to the SCOP 1.75 freeze date was dated 1999-11-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfolipid biosynthesis (SQD1) PROTEIN
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qrra_
  • Heterogens: SO4, NAD, UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qrrA (A:)
    mkrvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisr
    wkaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnn
    vigtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqass
    fyhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtal
    nrfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsv
    nelaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsl
    lnfavqfkdrvdtkqimpsvswkkigvktksmtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qrrA (A:)
    krvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisrw
    kaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnnv
    igtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqassf
    yhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtaln
    rfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsvn
    elaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsll
    nfavqfkdrvdtkqimpsvswkkigvktks