PDB entry 1qrk

View 1qrk on RCSB PDB site
Description:
Deposited on 1999-06-14, released 1999-07-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-02, with a file datestamp of 1999-07-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qrkA (A:)
    ggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdk
    yennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsg
    kwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwc
    eddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmd
    lsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenp
    vrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkds
    vwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfda
    pfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqe
    eerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnryt
    itaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffv
    tarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhld
    gpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qrkA (A:)
    ggrravppnnsnaaeddlptvelnvtsvhlfkerwdtnkvdhhtdkyennklivrrgqsf
    yvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmredrsv
    rlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnekere
    eyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvsrvg
    samvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfagvfn
    tflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneawmtr
    pdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdliyi
    takkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalmyga
    kkplntegvnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkae
    fkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
    tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
    tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qrkB (B:)
    grravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
    ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
    wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
    ddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdl
    sgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpv
    rygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsv
    wnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdap
    fvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqee
    erlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnryti
    taylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvt
    arinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldg
    pgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qrkB (B:)
    grravppnnsnaaeddlptvelqgvvlqeflnvtsvhlfkerwdtnkvdhhtdkyennkl
    ivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgaki
    vmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavy
    ldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgn
    pikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqc
    wvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhc
    wneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfae
    vnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlal
    etalmygakkplnsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytg
    vpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakq
    kstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfre
    irpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr