PDB entry 1qrh

View 1qrh on RCSB PDB site
Description: x-ray structure of the DNA-eco ri endonuclease complexes with an r145k mutation at 2.7 a
Class: hydrolase/DNA
Keywords: restriction endonuclease, DNA-protein complex, site-directed mutation, sequence-specific, x-ray crystallography, protein structure
Deposited on 1999-06-14, released 1999-06-23
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eco ri endonculease
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00642 (0-260)
      • engineered (128)
    Domains in SCOP 1.73: d1qrha_
  • Chain 'M':
    Compound: 5'-(tp*cp*gp*cp*gp*ap*ap*tp*tp*cp*gp*cp*g*)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qrhA (A:)
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaiekshkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

  • Chain 'M':
    No sequence available.