PDB entry 1qrd

View 1qrd on RCSB PDB site
Description: quinone reductase/fad/cibacron blue/duroquinone complex
Deposited on 1995-07-28, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qrda_
  • Chain 'B':
    Domains in SCOP 1.55: d1qrdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qrdA (A:)
    avrralivlahaertsfnyamkeaavealkkkgwevvesdlyamnfnplisrnditgepk
    dsenfqypvesslaykegrlspdivaeqkkleaadlvifqfplywfgvpailkgwfervl
    vagfaytyatmydkgpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarvqvlegwkkrletvweesplyfapsslfdlnfqagfllkk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qrdB (B:)
    avrralivlahaertsfnyamkeaavealkkkgwevvesdlyamnfnplisrnditgepk
    dsenfqypvesslaykegrlspdivaeqkkleaadlvifqfplywfgvpailkgwfervl
    vagfaytyatmydkgpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarvqvlegwkkrletvweesplyfapsslfdlnfqagfllkk
    evqeeqkknkfglsvghhlgksipadnqikark