PDB entry 1qrd

View 1qrd on RCSB PDB site
Description: quinone reductase/fad/cibacron blue/duroquinone complex
Class: quinone-reductase (cytosolic)
Keywords: quinone-reductase (cytosolic), oxidoreductase, flavoprotein
Deposited on 1995-07-28, released 1996-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinone-reductase
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qrda_
  • Chain 'B':
    Compound: quinone-reductase
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qrdb_
  • Heterogens: FAD, CBD, DQN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qrdA (A:)
    avrralivlahaertsfnyamkeaavealkkkgwevvesdlyamnfnplisrnditgepk
    dsenfqypvesslaykegrlspdivaeqkkleaadlvifqfplywfgvpailkgwfervl
    vagfaytyatmydkgpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarvqvlegwkkrletvweesplyfapsslfdlnfqagfllkk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qrdB (B:)
    avrralivlahaertsfnyamkeaavealkkkgwevvesdlyamnfnplisrnditgepk
    dsenfqypvesslaykegrlspdivaeqkkleaadlvifqfplywfgvpailkgwfervl
    vagfaytyatmydkgpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarvqvlegwkkrletvweesplyfapsslfdlnfqagfllkk
    evqeeqkknkfglsvghhlgksipadnqikark