PDB entry 1qr9

View 1qr9 on RCSB PDB site
Description: inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Deposited on 1999-06-18, released 1999-11-26
The last revision was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp41 envelope protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1qr9A (A:)
    sgivqqqnnllraieaqqhllqatvwgikqlqarsggrggwmewdreinnytslihslie
    esqnqqek