PDB entry 1qr8

View 1qr8 on RCSB PDB site
Description: inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Deposited on 1999-06-18, released 1999-11-26
The last revision prior to the SCOP 1.61 freeze date was dated 1999-11-26, with a file datestamp of 1999-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1qr8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qr8A (A:)
  sgivqqqnnllraieaqqhllqltvrgikqlqarsggrggwmewdreinnytslihslie
  esqnqqek