PDB entry 1qr7

View 1qr7 on RCSB PDB site
Description: crystal structure of phenylalanine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep
Deposited on 1999-06-18, released 1999-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-06-30, with a file datestamp of 2001-06-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qr7a_
  • Chain 'B':
    Domains in SCOP 1.59: d1qr7b_
  • Chain 'C':
    Domains in SCOP 1.59: d1qr7c_
  • Chain 'D':
    Domains in SCOP 1.59: d1qr7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qr7A (A:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qr7A (A:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqsllaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qr7B (B:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qr7B (B:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqsllaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qr7C (C:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qr7C (C:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqsllaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qr7D (D:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qr7D (D:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslplaygksitdacigwedtdallrqlanavkarrg