PDB entry 1qr2

View 1qr2 on RCSB PDB site
Description: human quinone reductase type 2
Deposited on 1999-04-15, released 1999-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qr2a_
  • Chain 'B':
    Domains in SCOP 1.55: d1qr2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qr2A (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qr2B (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq