PDB entry 1qqv

View 1qqv on RCSB PDB site
Description: solution structure of the headpiece domain of chicken villin
Class: structural protein
Keywords: f-actin binding domain, salt-bridge, structural protein
Deposited on 1999-06-08, released 1999-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: villin headpiece domain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qqva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqvA (A:)
    ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
    kkekglf