PDB entry 1qqu

View 1qqu on RCSB PDB site
Description: crystal structure of porcine beta trypsin with bound acetate ion
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 1999-06-09, released 2000-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta trypsin
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • conflict (144)
      • conflict (166)
    Domains in SCOP 1.73: d1qqua_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qquA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan