PDB entry 1qqt

View 1qqt on RCSB PDB site
Description: methionyl-trna synthetase from escherichia coli
Deposited on 1999-06-08, released 2000-01-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-01, with a file datestamp of 2000-01-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.17
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqtA (A:)
    vakkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlka
    qqlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknr
    tisqlydpekgmflpdrfvkgtcpkckspdqygdncevcgatyspteliepksvvsgatp
    vmrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgfei
    pnapgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyfhs
    lfwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyytak
    lssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpalyktft
    daaevigeawesrefgkavreimaladlanryvdeqapwvvakqagrdadlqaicsmgin
    lfrvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrqveal
    veaske