PDB entry 1qqs

View 1qqs on RCSB PDB site
Description: neutrophil gelatinase associated lipocalin homodimer
Deposited on 1999-06-07, released 2000-04-21
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-21, with a file datestamp of 2000-04-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qqsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qqsA (A:)
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyeekedas
ynvtsvlfrkkkcdyairtfvpgcqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselknnfirfskslglpenhivfpvpidqcid