PDB entry 1qqi

View 1qqi on RCSB PDB site
Description: solution structure of the DNA-binding and transactivation domain of phob from escherichia coli
Class: transcription
Keywords: WINGED HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSCRIPTION
Deposited on 1999-06-07, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qqia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqiA (A:)
    maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwg
    tnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf