PDB entry 1qqh

View 1qqh on RCSB PDB site
Description: 2.1 a crystal structure of the human papillomavirus type 18 e2 activation domain
Deposited on 1999-06-05, released 1999-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.256
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qqha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qqhA (A:)
kskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqvyfdgnk
dncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefksecekygntgtw
evhfgnnvidcndsmcstsddtvs