PDB entry 1qqh

View 1qqh on RCSB PDB site
Description: 2.1 a crystal structure of the human papillomavirus type 18 e2 activation domain
Class: Viral protein
Keywords: AMPHIPATHIC HELIX, CASHEW/KIDNEY SHAPE, Viral protein
Deposited on 1999-06-05, released 1999-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.256
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papillomavirus transcription factor e2
    Species: Human papillomavirus type 18 [TaxId:333761]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (0-143)
      • mutation (20)
    Domains in SCOPe 2.07: d1qqha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqhA (A:)
    kskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqvyfdgnk
    dncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefksecekygntgtw
    evhfgnnvidcndsmcstsddtvs