PDB entry 1qqg

View 1qqg on RCSB PDB site
Description: crystal structure of the ph-ptb targeting region of irs-1
Class: signal transduction
Keywords: beta-sandwhich
Deposited on 1999-06-04, released 1999-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin receptor substrate 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qqga1, d1qqga2
  • Chain 'B':
    Compound: insulin receptor substrate 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qqgb1, d1qqgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqgA (A:)
    ppesdgfsdvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrs
    iplescfninkradsknkhlvalytrdehfaiaadseaeqdswyqallqlhnrakghhdg
    aaalgagggggscsgssglgeagedlsygdvppgpafkevwqvilkpkglgqtknligiy
    rlcltsktisfvklnseaaavvlqlmnirrcghsenfffievgrsavtgpgefwmqvdds
    vvaqnmhetileamramsdefrpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqgA (A:)
    dvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiplescfn
    inkradsknkhlvalytrdehfaiaadseaeqdswyqallqlhafkevwqvilkpkglgq
    tknligiyrlcltsktisfvklnseaaavvlqlmnirrcghsenfffievgrsavtgpge
    fwmqvddsvvaqnmhetileamramsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qqgB (B:)
    ppesdgfsdvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrs
    iplescfninkradsknkhlvalytrdehfaiaadseaeqdswyqallqlhnrakghhdg
    aaalgagggggscsgssglgeagedlsygdvppgpafkevwqvilkpkglgqtknligiy
    rlcltsktisfvklnseaaavvlqlmnirrcghsenfffievgrsavtgpgefwmqvdds
    vvaqnmhetileamramsdefrpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqgB (B:)
    sdvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiplescf
    ninkradsknkhlvalytrdehfaiaadseaeqdswyqallqlhafkevwqvilkpkglg
    qtknligiyrlcltsktisfvklnseaaavvlqlmnirrcghsenfffievgrsavtgpg
    efwmqvddsvvaqnmhetileamramsdef