PDB entry 1qqf

View 1qqf on RCSB PDB site
Description: n-terminally truncated c3d,g fragment of the complement system
Class: immune system
Keywords: alpha-alpha barrel, complement, immune system
Deposited on 1999-06-04, released 2000-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.164
AEROSPACI score: -1.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (complement c3dg)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01026 (0-276)
      • conflict (71-72)
      • conflict (75)
      • modified residue (0)
    Domains in SCOPe 2.08: d1qqfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqfA (A:)
    cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
    nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
    iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
    aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
    ppvvrwlnderyygggygstqatfmvfqalaqyradv