PDB entry 1qqe

View 1qqe on RCSB PDB site
Description: crystal structure of the vesicular transport protein sec17
Class: protein transport
Keywords: helix-turn-helix tpr-like repeat, protein transport
Deposited on 1999-06-04, released 1999-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.26
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vesicular transport protein sec17
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32602 (0-End)
      • engineered (0)
    Domains in SCOPe 2.06: d1qqea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqeA (A:)
    isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
    lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
    felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
    ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsedpnfadsresnf
    lkslidavnegdseqlsehckefdnfmrldkwkitilnkikesiqqqeddll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqeA (A:)
    isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
    lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
    felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
    ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsesnflkslidavn
    egdseqlsehckefdnfmrldkwkitilnkikesiqqqedd