PDB entry 1qqe

View 1qqe on RCSB PDB site
Description: crystal structure of the vesicular transport protein sec17
Deposited on 1999-06-04, released 1999-09-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-08, with a file datestamp of 1999-09-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.26
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qqea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqeA (A:)
    isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
    lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
    felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
    ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsedpnfadsresnf
    lkslidavnegdseqlsehckefdnfmrldkwkitilnkikesiqqqedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqeA (A:)
    isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
    lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
    felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
    ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsesnflkslidavn
    egdseqlsehckefdnfmrldkwkitilnkikesiqqqedd