PDB entry 1qqd

View 1qqd on RCSB PDB site
Description:
Deposited on 1999-06-03, released 1999-12-08
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-08, with a file datestamp of 1999-12-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qqda1, d1qqda2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qqdb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqdA (A:)
    shsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeywd
    retqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydgk
    dyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlqr
    aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
    qkwaavvvpsgeeqrytchvqheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqdB (B:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfsgd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd