PDB entry 1qqa

View 1qqa on RCSB PDB site
Description: purine repressor mutant-hypoxanthine-palindromic operator complex
Class: gene regulation/DNA
Keywords: transcription regulation, DNA-binding, repressor, purine biosynthesis, complex (DNA-binding protein-DNA), gene regulation-DNA complex
Deposited on 1999-06-01, released 1999-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purine nucleotide synthesis repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7
      • engineered (53)
    Domains in SCOPe 2.07: d1qqaa1, d1qqaa2
  • Chain 'M':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*gp*cp*gp*cp*tp*tp*gp*cp*gp*t)-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqaA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqaA (A:)
    tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnhtksi
    gllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvm
    cseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghreig
    vipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpta
    vfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetaf
    nmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'M':
    No sequence available.