PDB entry 1qq4

View 1qq4 on RCSB PDB site
Description: crystal structure of an alpha-lytic protease mutant with accelerated folding kinetics, r102h/g134s
Deposited on 1999-06-10, released 1999-06-15
The last revision prior to the SCOP 1.65 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.174
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qq4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qq4A (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavchsgrttgyqcgtitaknvt
    anyaegavrgltqsnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg