PDB entry 1qpz

View 1qpz on RCSB PDB site
Description: purine repressor-hypoxanthine-palindromic operator complex
Class: transcription/DNA
Keywords: transcription regulation, DNA-binding, repressor, purine biosynthesis, complex (DNA-binding protein-DNA), transcription-DNA complex
Deposited on 1999-06-01, released 1999-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purine nucleotide synthesis repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpza1, d1qpza2
  • Chain 'M':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t)-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpzA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpzA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'M':
    No sequence available.